Logo  

IPv4info FOR SALE  

Tools  

API  

Store  

Statistics  

Search:  
  
(domain, ip, ASN or company name)
 

EN   |  RU  

  Your ip: 18.232.55.175      MIT     AS14618     
United States  
  Details...    Login    198 

   <<  

IP address
   <<   216.36.220.3 >>  

Block start 216.36.192.0
End of block 216.36.255.255
Block size 16384      
Domains in block
Block name HOSTWAY-04
AS number 3064
Parent block 216.0.0.0 - 216.255.255.255
Organization Hostway Corporation
City Chicago
Region/State Illinois
Country
US , United States
Reg. date 2000-08-15
Host name wtf312.chi.us.siteprotect.com
Domain count >= 26    
Servers around
Domains 1 Favicon icon
carlsonanddeklerk.com 
2 Favicon icon
colony54.com 
3 Favicon icon
criminaldefendernyc.com 
4 Favicon icon
findacriminaldefenselawyer.com 
5 Favicon icon
findafamilylawyer.com 
6 Favicon icon
findahairsalon.com 
7 Favicon icon
findalocalappraiser.com 
8 Favicon icon
findalocalcosmeticdentist.com 
9 Favicon icon
findalocalcpa.com 
10 Favicon icon
findalocaldayspa.com 
11 Favicon icon
findalocalnotary.com 
12 Favicon icon
findamedicalmalpracticelawyer.com 
13 Favicon icon
findanetworkadmin.com 
14 Favicon icon
findanimmigrationlawyer.com 
15 Favicon icon
findanipattorney.com 
16 Favicon icon
findapersonalinjurylawyer.com 
17 Favicon icon
findarealestatelawyer.com 
18 Favicon icon
findyourcosmeticsurgeon.com 
19 Favicon icon
findyourflowershop.com 
20 Favicon icon
lawyervioxx.com 
21 Favicon icon
mail.findanetworkadmin.com 
22 Favicon icon
plasticsurgeonburbank.com 
23 Favicon icon
scorpionaccountant.com 
24 Favicon icon
www.findyourcosmeticsurgeon.com 
25 Favicon icon
www.findyourflowershop.com 
26 Favicon icon
yourhoustoncpa.com 



   >>