Logo  

IPv4info FOR SALE  

Tools  

API  

Store  

Statistics  

Search:  
  
(domain, ip, ASN or company name)
 

EN   |  RU  

  Your ip: 3.84.130.252      GE-INTERNET     AS14618     
United States  
  Details...    Login    129 

Domains in block
208.75.220.0 - 208.75.223.255

Net block: 208.75.220.0 - 208.75.223.255
Block name: WSOL
Block size:1024
Organization: WebSolutionsTechnology
Parent block: 208.0.0.0-208.255.255.255
US, United States, Aurora
               
N ip domain web server powered by host name updated
1208.75.220.33 Favicon icon
advancedlendingsupport.com 
Apache/2.2.3 (CentOS)  
PHP/5.3.3 no record 2016-01-25
2208.75.220.33 Favicon icon
allisonblog.wsoldev.com 
Apache/2.2.3 (CentOS)  
PHP/5.3.3 no record 2015-11-14
3208.75.220.33 Favicon icon
bradblog.wsoldev.com 
Apache/2.2.3 (CentOS)  
PHP/5.3.3 no record 2015-11-14
4208.75.220.33 Favicon icon
chris.wsoldev.com 
Apache/2.2.3 (CentOS)  
PHP/5.3.3 no record 2015-11-14
5208.75.220.57 Favicon icon
ilovemynonna.com 
Microsoft-IIS/7.5  
ASP.NET no record 2015-12-02
6208.75.220.59 Favicon icon
vmi.wsol.net 
_ no record 2015-11-14
7208.75.220.64 Favicon icon
ek802s2b.wsoldev.com 
Microsoft-IIS/7.5  
ASP.NET no record 2015-10-30
8208.75.220.72 Favicon icon
thisbradylife.com 
Microsoft-IIS/6.0  
ASP.NET no record 2015-12-02
9208.75.220.74 Favicon icon
centralstatescoachrepairs.com 
_ no record 2015-12-02
10208.75.220.75 Favicon icon
trotandpace.com 
Microsoft-IIS/6.0  
ASP.NET no record 2015-12-02
11208.75.220.83 Favicon icon
barangan.com 
Microsoft-IIS/6.0  
ASP.NET no record 2015-12-02
12208.75.220.91 Favicon icon
trees-invest.com 
_ no record 2015-12-02
13208.75.220.93 Favicon icon
dupage-buildingtrades.org 
Microsoft-IIS/6.0  
ASP.NET no record 2015-12-02
14208.75.220.93 Favicon icon
www.dupage-buildingtrades.org 
Microsoft-IIS/6.0  
ASP.NET no record 2015-11-14
15208.75.220.98 Favicon icon
binghamquarterhorse.com 
Microsoft-IIS/6.0  
ASP.NET no record 2015-12-02
16208.75.220.99 Favicon icon
bus-charter.com 
Microsoft-IIS/6.0  
ASP.NET no record 2015-12-02
17208.75.220.99 Favicon icon
www.bus-charter.com 
Microsoft-IIS/6.0  
ASP.NET no record 2016-01-25
18208.75.220.100 Favicon icon
epoa.net 
Microsoft-IIS/6.0  
ASP.NET no record 2016-01-25
19208.75.220.100 Favicon icon
www.epoa.net 
Microsoft-IIS/6.0  
ASP.NET no record 2016-01-25
20208.75.220.101 Favicon icon
turnonecamping.com 
Microsoft-IIS/6.0  
ASP.NET no record 2015-12-02
21208.75.220.106 Favicon icon
cfwill.com 
Microsoft-IIS/6.0  
ASP.NET no record 2015-12-02
22208.75.220.106 Favicon icon
cfwill.org 
Microsoft-IIS/6.0  
ASP.NET no record 2015-11-14
23208.75.220.106 Favicon icon
willcountycf.org 
Microsoft-IIS/6.0  
ASP.NET no record 2015-12-02
24208.75.220.106 Favicon icon
www.willcountycf.org 
Microsoft-IIS/6.0  
ASP.NET no record 2015-12-02
25208.75.220.109 Favicon icon
oldforum.vibinst.org 
Microsoft-IIS/6.0  
ASP.NET no record 2016-02-17
26208.75.220.112 Favicon icon
www.bloomingdalehackers.com 
Microsoft-IIS/7.5  
ASP.NET no record 2016-01-25
27208.75.220.124 Favicon icon
poeadv.com 
Microsoft-IIS/6.0  
ASP.NET no record 2015-12-02
28208.75.220.131 Favicon icon
heroeswest.biz 
Microsoft-IIS/6.0  
ASP.NET no record 2015-12-02
29208.75.220.131 Favicon icon
heroeswest.net 
Microsoft-IIS/6.0  
ASP.NET no record 2016-01-25
30208.75.220.131 Favicon icon
heroeswest.org 
Microsoft-IIS/6.0  
ASP.NET no record 2015-12-02
31208.75.220.131 Favicon icon
heroswest.com 
Microsoft-IIS/6.0  
ASP.NET no record 2015-12-02
32208.75.220.131 Favicon icon
heroswest.net 
Microsoft-IIS/6.0  
ASP.NET no record 2016-01-25
33208.75.220.147 Favicon icon
neurosurgicalsociety.com 
Microsoft-IIS/6.0  
ASP.NET no record 2015-12-02
34208.75.220.157 Favicon icon
amzozip.com 
_ no record 2015-12-02
35208.75.220.158 Favicon icon
coraleecandies.com 
Microsoft-IIS/6.0  
ASP.NET no record 2015-12-02
36208.75.220.158 Favicon icon
www.coraleecandies.com 
Microsoft-IIS/6.0  
ASP.NET no record 2015-11-14
37208.75.220.164 Favicon icon
gift-of-hope.org 
Microsoft-IIS/6.0  
ASP.NET no record 2015-12-02
38208.75.220.164 Favicon icon
www.giftofhope.org 
Microsoft-IIS/6.0  
ASP.NET no record 2015-12-02
39208.75.220.173 Favicon icon
gammongroup.com 
Microsoft-IIS/6.0  
ASP.NET no record 2015-12-02
40208.75.220.173 Favicon icon
www.gammongroup.com 
Microsoft-IIS/6.0  
ASP.NET no record 2015-12-02
41208.75.220.184 Favicon icon
eassociationmanager.com 
Microsoft-IIS/6.0  
ASP.NET no record 2015-12-02
42208.75.220.184 Favicon icon
www.eassociationmanager.com 
Microsoft-IIS/6.0  
ASP.NET no record 2015-12-02
43208.75.220.193 Favicon icon
dfmusicinc.com 
Microsoft-IIS/6.0  
ASP.NET no record 2016-01-25
44208.75.220.193 Favicon icon
www.dfmusicinc.com 
Microsoft-IIS/6.0  
ASP.NET no record 2016-01-25
45208.75.220.198 Favicon icon
ibew701fbo.net 
Microsoft-IIS/6.0  
ASP.NET no record 2016-01-25
46208.75.220.220 Favicon icon
gmsupplies.com 
Microsoft-IIS/7.5  
ASP.NET no record 2016-01-25
47208.75.220.220 Favicon icon
www.gmsupplies.com 
Microsoft-IIS/7.5  
ASP.NET no record 2016-01-25
48208.75.220.224 Favicon icon
willcareers.com 
Microsoft-IIS/6.0  
ASP.NET no record 2015-12-02
49208.75.220.224 Favicon icon
www.willcareers.com 
Microsoft-IIS/6.0  
ASP.NET no record 2016-01-25
50208.75.220.242 Favicon icon
cichealth.org 
Microsoft-IIS/6.0  
ASP.NET no record 2015-11-14
51208.75.220.242 Favicon icon
www.cichealth.org 
Microsoft-IIS/6.0  
ASP.NET no record 2015-11-14
52208.75.220.251 Favicon icon
realtorchannel.org 
_ no record 2015-12-02
53208.75.220.251 Favicon icon
www.realtorchannel.net 
_ no record 2016-01-25
54208.75.221.1 Favicon icon
ns1.wsol.com 
_ ns1.wsol.com 2015-11-14
55208.75.221.2 Favicon icon
ns2.wsol.com 
_ ns2.wsol.com 2015-11-14
56208.75.221.5 Favicon icon
ns5.wsol.com 
_ ns5.wsol.com 2015-11-14
57208.75.221.6 Favicon icon
ns6.wsol.com 
_ ns6.wsol.com 2015-11-14
58208.75.221.9 Favicon icon
traibar.com 
Microsoft-IIS/6.0  
ASP.NET no record 2015-12-02
59208.75.221.28 Favicon icon
m1dist.com 
Microsoft-IIS/6.0  
ASP.NET no record 2015-12-02
60208.75.221.28 Favicon icon
www.m1dist.com 
Microsoft-IIS/6.0  
ASP.NET no record 2015-12-02
61208.75.221.31 Favicon icon
crustease.com 
Microsoft-IIS/7.5  
ASP.NET no record 2015-12-02
62208.75.221.31 Favicon icon
krusteaz.com 
Microsoft-IIS/7.5  
ASP.NET no record 2015-12-02
63208.75.221.31 Favicon icon
krusteazonestep.com 
Microsoft-IIS/7.5  
ASP.NET no record 2015-12-02
64208.75.221.34 Favicon icon
theeducationcenter.org 
Microsoft-IIS/6.0  
ASP.NET no record 2015-12-02
65208.75.221.36 Favicon icon
crimestoppersofwillcounty.org 
Microsoft-IIS/6.0  
ASP.NET no record 2015-12-02
66208.75.221.36 Favicon icon
www.crimestoppersofwillcounty.org 
Microsoft-IIS/6.0  
ASP.NET no record 2015-11-14
67208.75.221.51 Favicon icon
stonechemical.com 
Microsoft-IIS/6.0  
ASP.NET no record 2015-12-02
68208.75.221.51 Favicon icon
www.stonechemical.com 
Microsoft-IIS/6.0  
ASP.NET no record 2015-12-02
69208.75.221.78 Favicon icon
paggo.com 
Microsoft-IIS/6.0  
ASP.NET no record 2015-12-02
70208.75.221.78 Favicon icon
www.paggo.com 
Microsoft-IIS/6.0  
ASP.NET no record 2015-12-02
71208.75.221.80 Favicon icon
chicagobootco.com 
Microsoft-IIS/6.0  
ASP.NET no record 2015-12-02
72208.75.221.80 Favicon icon
chicagobootcompany.com 
Microsoft-IIS/6.0  
ASP.NET no record 2015-12-02
73208.75.221.85 Favicon icon
winetastingevent.com 
Microsoft-IIS/6.0  
ASP.NET no record 2015-12-02
74208.75.221.90 Favicon icon
brindac.com 
Microsoft-IIS/6.0  
ASP.NET no record 2015-12-02
75208.75.221.91 Favicon icon
bachiwinder.com 
Microsoft-IIS/6.0  
ASP.NET no record 2015-12-02
76208.75.221.91 Favicon icon
www.bachiwinder.com 
Microsoft-IIS/6.0  
ASP.NET no record 2016-01-25
77208.75.221.99 Favicon icon
pna-usa.com 
Microsoft-IIS/6.0  
ASP.NET no record 2015-12-02
78208.75.221.103 Favicon icon
vitellspitzlaw.com 
Microsoft-IIS/6.0  
ASP.NET no record 2015-12-02
79208.75.221.103 Favicon icon
vslawltd.com 
Microsoft-IIS/6.0  
ASP.NET no record 2015-12-02
80208.75.221.103 Favicon icon
vsslaw.com 
Microsoft-IIS/6.0  
ASP.NET no record 2015-12-02
81208.75.221.103 Favicon icon
www.vslawltd.com 
Microsoft-IIS/6.0  
ASP.NET no record 2015-11-14
82208.75.221.103 Favicon icon
www.vsslaw.com 
Microsoft-IIS/6.0  
ASP.NET no record 2015-11-14
83208.75.221.110 Favicon icon
uni-carrier.com 
Microsoft-IIS/6.0  
ASP.NET no record 2015-12-02
84208.75.221.110 Favicon icon
unicarrier.com 
Microsoft-IIS/6.0  
ASP.NET no record 2015-12-02
85208.75.221.110 Favicon icon
www.uni-carrier.com 
Microsoft-IIS/6.0  
ASP.NET no record 2015-11-14
86208.75.221.112 Favicon icon
divorce-law-illinois.com 
Microsoft-IIS/6.0  
ASP.NET no record 2016-01-25
87208.75.221.112 Favicon icon
www.divorce-law-illinois.com 
Microsoft-IIS/6.0  
ASP.NET no record 2016-01-25
88208.75.221.130 Favicon icon
jscinvestments.com 
Microsoft-IIS/6.0  
ASP.NET no record 2015-12-02
89208.75.221.130 Favicon icon
www.jscinvestments.com 
Microsoft-IIS/6.0  
ASP.NET no record 2015-12-02
90208.75.221.132 Favicon icon
richindustries.com 
Microsoft-IIS/6.0  
ASP.NET no record 2015-12-02
91208.75.221.133 Favicon icon
chicagoelectric.com 
Microsoft-IIS/6.0  
ASP.NET no record 2015-12-02
92208.75.221.133 Favicon icon
www.chicagoelectric.com 
Microsoft-IIS/6.0  
ASP.NET no record 2015-12-02
93208.75.221.136 Favicon icon
flcpartners.com 
Microsoft-IIS/6.0  
ASP.NET no record 2015-12-02
94208.75.221.144 Favicon icon
www.togls.com 
Microsoft-IIS/6.0  
ASP.NET no record 2016-01-25
95208.75.221.145 Favicon icon
ebeamsupplies.com 
_ no record 2015-12-02
96208.75.221.150 Favicon icon
www.midwesttime.com 
Microsoft-IIS/6.0  
ASP.NET no record 2016-01-25
97208.75.221.151 Favicon icon
hardenengineering.com 
Microsoft-IIS/6.0  
ASP.NET no record 2015-12-02
98208.75.221.153 Favicon icon
dzarch.com 
Microsoft-IIS/6.0  
ASP.NET no record 2016-01-25
99208.75.221.153 Favicon icon
www.dzarch.com 
Microsoft-IIS/6.0  
ASP.NET no record 2016-01-25
100208.75.221.156 Favicon icon
akfentertainment.com 
Microsoft-IIS/6.0  
ASP.NET no record 2015-12-02
101208.75.221.156 Favicon icon
arabianknightsfarms.com 
Microsoft-IIS/6.0  
ASP.NET no record 2015-12-02
102208.75.221.156 Favicon icon
vciconsulting.com 
Microsoft-IIS/6.0  
ASP.NET no record 2015-12-02
103208.75.221.156 Favicon icon
www.akfentertainment.com 
Microsoft-IIS/6.0  
ASP.NET no record 2015-12-02
104208.75.221.160 Favicon icon
thepmcgroup.com 
Microsoft-IIS/6.0  
ASP.NET no record 2015-12-02
105208.75.221.161 Favicon icon
righteoushillbillies.com 
Microsoft-IIS/6.0  
ASP.NET no record 2015-12-02
106208.75.221.165 Favicon icon
rmminc.net 
Microsoft-IIS/6.0  
ASP.NET no record 2016-01-25
107208.75.221.165 Favicon icon
www.rmminc.net 
Microsoft-IIS/6.0  
ASP.NET no record 2016-01-25
108208.75.221.167 Favicon icon
thepettingzoo.org 
Microsoft-IIS/6.0  
ASP.NET no record 2015-12-02
109208.75.221.169 Favicon icon
corkedthecomic.com 
Microsoft-IIS/6.0  
ASP.NET no record 2015-12-02
110208.75.221.175 Favicon icon
gadco.com 
_ no record 2015-12-02
111208.75.221.175 Favicon icon
www.gadco.com 
_ no record 2015-11-14
112208.75.221.176 Favicon icon
buyektron.com 
Microsoft-IIS/6.0  
ASP.NET no record 2015-12-02
113208.75.221.179 Favicon icon
jardis.com 
Microsoft-IIS/6.0  
ASP.NET no record 2015-12-02
114208.75.221.179 Favicon icon
www.jardis.com 
Microsoft-IIS/6.0  
ASP.NET no record 2015-12-02
115208.75.221.185 Favicon icon
aschinbergpediatrics.com 
Microsoft-IIS/6.0  
ASP.NET no record 2015-12-02
116208.75.221.185 Favicon icon
www.topkidsdocs.com 
Microsoft-IIS/6.0  
ASP.NET no record 2016-01-25
117208.75.221.188 Favicon icon
medicaresupplement.net 
_ no record 2016-01-25
118208.75.221.190 Favicon icon
iamareyou.org 
_ no record 2015-12-02
119208.75.221.193 Favicon icon
barretharvey.com 
Microsoft-IIS/6.0  
ASP.NET no record 2015-12-02
120208.75.221.195 Favicon icon
bergesonconstruction.com 
Microsoft-IIS/6.0  
ASP.NET no record 2015-12-02
121208.75.221.196 Favicon icon
chicagost.com 
Microsoft-IIS/6.0  
ASP.NET no record 2015-12-02
122208.75.221.196 Favicon icon
www.chicagost.com 
Microsoft-IIS/6.0  
ASP.NET no record 2015-11-14
123208.75.221.197 Favicon icon
buchar.com 
Microsoft-IIS/6.0  
ASP.NET no record 2015-12-02
124208.75.221.205 Favicon icon
kernelsweetooth.com 
Microsoft-IIS/6.0  
ASP.NET no record 2015-12-02
125208.75.221.216 Favicon icon
eraconsultants.com 
Microsoft-IIS/6.0  
ASP.NET no record 2015-12-02
126208.75.221.216 Favicon icon
mail.eraconsultants.com 
Microsoft-IIS/6.0  
ASP.NET no record 2015-11-14
127208.75.221.229 Favicon icon
*.njsharingnetwork.org 
Microsoft-IIS/6.0  
ASP.NET no record 2017-05-05
128208.75.221.229 Favicon icon
donatelife.co 
Microsoft-IIS/6.0  
ASP.NET no record 2016-11-14
129208.75.221.229 Favicon icon
donatelifenewjersey.org 
Microsoft-IIS/6.0  
ASP.NET no record 2015-12-02
130208.75.221.229 Favicon icon
donatelifenj.co 
Microsoft-IIS/6.0  
ASP.NET no record 2016-10-28
131208.75.221.229 Favicon icon
giftoflife.co 
Microsoft-IIS/6.0  
ASP.NET no record 2016-10-23
132208.75.221.229 Favicon icon
kidneytransplant.co 
Microsoft-IIS/6.0  
ASP.NET no record 2016-10-23
133208.75.221.229 Favicon icon
njsharingnetwork.org 
Microsoft-IIS/6.0  
ASP.NET no record 2015-12-02
134208.75.221.229 Favicon icon
njsharingnetworkfoundation.com 
Microsoft-IIS/6.0  
ASP.NET no record 2015-12-02
135208.75.221.229 Favicon icon
njsharingnetworkfoundation.net 
Microsoft-IIS/6.0  
ASP.NET no record 2016-01-25
136208.75.221.229 Favicon icon
njsharingnetworkfoundation.org 
Microsoft-IIS/6.0  
ASP.NET no record 2015-12-02
137208.75.221.229 Favicon icon
organdonor.co 
Microsoft-IIS/6.0  
ASP.NET no record 2016-11-14
138208.75.221.229 Favicon icon
organtransplant.co 
Microsoft-IIS/6.0  
ASP.NET no record 2016-10-28
139208.75.221.229 Favicon icon
savelives.co 
Microsoft-IIS/6.0  
ASP.NET no record 2016-10-23
140208.75.221.229 Favicon icon
sharenj.co 
Microsoft-IIS/6.0  
ASP.NET no record 2016-10-23
141208.75.221.229 Favicon icon
tissuedonor.co 
Microsoft-IIS/6.0  
ASP.NET no record 2016-10-23
142208.75.221.231 Favicon icon
landmarkdestinations.com 
Microsoft-IIS/6.0  
ASP.NET no record 2015-12-02
143208.75.221.236 Favicon icon
jada.org 
Microsoft-IIS/6.0  
ASP.NET no record 2015-12-02
144208.75.221.236 Favicon icon
mail.jada.org 
Microsoft-IIS/6.0  
ASP.NET no record 2015-11-14
145208.75.221.238 Favicon icon
trma.org 
Microsoft-IIS/6.0  
ASP.NET no record 2015-12-02
146208.75.221.238 Favicon icon
www.trma.org 
Microsoft-IIS/6.0  
ASP.NET no record 2015-12-02
147208.75.221.240 Favicon icon
brandition.com 
Apache PHP/5.4.8--pl0-gentoo no record 2015-12-02
148208.75.221.240 Favicon icon
brian.wsoldev.com 
Apache PHP/5.4.8--pl0-gentoo no record 2015-11-14
149208.75.221.240 Favicon icon
dirtygreenmusic.com 
Apache PHP/5.4.8--pl0-gentoo no record 2016-01-25
150208.75.221.240 Favicon icon
foxriverlawncare.com 
Apache PHP/5.4.8--pl0-gentoo no record 2016-01-25
151208.75.221.240 Favicon icon
joanbueta.com 
Apache PHP/5.4.8--pl0-gentoo no record 2016-05-08
152208.75.221.240 Favicon icon
milkandbeans.com 
Apache PHP/5.4.8--pl0-gentoo no record 2015-11-14
153208.75.221.240 Favicon icon
raissabailey.com 
Apache PHP/5.4.8--pl0-gentoo no record 2015-12-02
154208.75.221.240 Favicon icon
rebandcreative.com 
Apache PHP/5.4.8--pl0-gentoo no record 2015-11-14
155208.75.221.240 Favicon icon
robotregime.com 
Apache PHP/5.4.8--pl0-gentoo no record 2015-12-02
156208.75.221.240 Favicon icon
seerobrun.com 
Apache PHP/5.4.8--pl0-gentoo no record 2015-12-02
157208.75.221.240 Favicon icon
thecrimsoncalla.com 
Apache PHP/5.4.8--pl0-gentoo no record 2015-12-02
158208.75.221.240 Favicon icon
www.dirtygreenmusic.com 
Apache PHP/5.4.8--pl0-gentoo no record 2016-01-25
159208.75.221.240 Favicon icon
www.foxriverlawncare.com 
Apache PHP/5.4.8--pl0-gentoo no record 2016-01-25
160208.75.221.240 Favicon icon
www.robotregime.com 
Apache PHP/5.4.8--pl0-gentoo no record 2015-11-14
161208.75.221.242 Favicon icon
advancedconstructionrestorationservices.com 
Apache no record 2015-11-14
162208.75.221.243 Favicon icon
www.foodbroker.net 
Apache no record 2016-01-25
163208.75.222.23 Favicon icon
advancedcardiovascularinstitute.com 
Microsoft-IIS/7.5  
ASP.NET no record 2015-12-02
164208.75.222.23 Favicon icon
advancedcardiovascularinstitute.net 
Microsoft-IIS/7.5  
ASP.NET no record 2016-01-25
165208.75.222.23 Favicon icon
advancedcardiovascularinstitute.org 
Microsoft-IIS/7.5  
ASP.NET no record 2015-12-02
166208.75.222.23 Favicon icon
annecammpsychology.com 
Microsoft-IIS/7.5  
ASP.NET no record 2015-12-02
167208.75.222.23 Favicon icon
annecammpsychology.net 
Microsoft-IIS/7.5  
ASP.NET no record 2016-01-25
168208.75.222.23 Favicon icon
annecammpsychology.org 
Microsoft-IIS/7.5  
ASP.NET no record 2015-12-02
169208.75.222.23 Favicon icon
beavercreekfamilymedicine.com 
Microsoft-IIS/7.5  
ASP.NET no record 2015-12-02
170208.75.222.23 Favicon icon
beavercreekfamilymedicine.net 
Microsoft-IIS/7.5  
ASP.NET no record 2016-01-25
171208.75.222.23 Favicon icon
beavercreekfamilymedicine.org 
Microsoft-IIS/7.5  
ASP.NET no record 2015-11-14
172208.75.222.23 Favicon icon
beavercreekfamilyphysicians.com 
Microsoft-IIS/7.5  
ASP.NET no record 2015-12-02
173208.75.222.23 Favicon icon
beavercreekfamilyphysicians.net 
Microsoft-IIS/7.5  
ASP.NET no record 2016-01-25
174208.75.222.23 Favicon icon
beavercreekfamilyphysicians.org 
Microsoft-IIS/7.5  
ASP.NET no record 2015-11-14
175208.75.222.23 Favicon icon
beavercreekobgyn.com 
Microsoft-IIS/7.5  
ASP.NET no record 2015-12-02
176208.75.222.23 Favicon icon
beavercreekobgyn.net 
Microsoft-IIS/7.5  
ASP.NET no record 2016-01-25
177208.75.222.23 Favicon icon
beavercreekobgyn.org 
Microsoft-IIS/7.5  
ASP.NET no record 2015-11-14
178208.75.222.23 Favicon icon
belmontphysicians.net 
Microsoft-IIS/7.5  
ASP.NET no record 2016-01-25
179208.75.222.23 Favicon icon
belmontphysicians.org 
Microsoft-IIS/7.5  
ASP.NET no record 2015-11-14
180208.75.222.23 Favicon icon
brookvillefamilycare.com 
Microsoft-IIS/7.5  
ASP.NET no record 2015-12-02
181208.75.222.23 Favicon icon
brookvillefamilycare.net 
Microsoft-IIS/7.5  
ASP.NET no record 2016-01-25
182208.75.222.23 Favicon icon
brookvillefamilycare.org 
Microsoft-IIS/7.5  
ASP.NET no record 2015-11-14
183208.75.222.23 Favicon icon
bullfamilydiabetescenter.com 
Microsoft-IIS/7.5  
ASP.NET no record 2015-12-02
184208.75.222.23 Favicon icon
bullfamilydiabetescenter.net 
Microsoft-IIS/7.5  
ASP.NET no record 2016-01-25
185208.75.222.23 Favicon icon
bullfamilydiabetescenter.org 
Microsoft-IIS/7.5  
ASP.NET no record 2016-01-25
186208.75.222.23 Favicon icon
cardiovascularinstitutedayton.com 
Microsoft-IIS/7.5  
ASP.NET no record 2015-12-02
187208.75.222.23 Favicon icon
cardiovascularinstitutedayton.net 
Microsoft-IIS/7.5  
ASP.NET no record 2016-01-25
188208.75.222.23 Favicon icon
cardiovascularinstitutedayton.org 
Microsoft-IIS/7.5  
ASP.NET no record 2015-11-14
189208.75.222.23 Favicon icon
centervillehealthcare.com 
Microsoft-IIS/7.5  
ASP.NET no record 2015-12-02
190208.75.222.23 Favicon icon
centervillehealthcare.net 
Microsoft-IIS/7.5  
ASP.NET no record 2016-01-25
191208.75.222.23 Favicon icon
centervillehealthcare.org 
Microsoft-IIS/7.5  
ASP.NET no record 2015-11-14
192208.75.222.23 Favicon icon
clinicalneuroscienceinstitute.com 
Microsoft-IIS/7.5  
ASP.NET no record 2015-11-14
193208.75.222.23 Favicon icon
clinicalneuroscienceinstitute.net 
Microsoft-IIS/7.5  
ASP.NET no record 2016-01-25
194208.75.222.23 Favicon icon
clinicalneuroscienceinstitute.org 
Microsoft-IIS/7.5  
ASP.NET no record 2015-11-14
195208.75.222.23 Favicon icon
comprehensiveburnandwound.com 
Microsoft-IIS/7.5  
ASP.NET no record 2016-10-04
196208.75.222.23 Favicon icon
comprehensiveburnandwound.net 
Microsoft-IIS/7.5  
ASP.NET no record 2016-10-04
197208.75.222.23 Favicon icon
comprehensiveburnandwound.org 
Microsoft-IIS/7.5  
ASP.NET no record 2016-10-04
198208.75.222.23 Favicon icon
daytonheart.com 
Microsoft-IIS/7.5  
ASP.NET no record 2015-12-02
199208.75.222.23 Favicon icon
dulanandmooredulan.com 
Microsoft-IIS/7.5  
ASP.NET no record 2016-01-25
200208.75.222.23 Favicon icon
dulanandmooredulan.net 
Microsoft-IIS/7.5  
ASP.NET no record 2016-01-25
Next page