Logo  

IPv4info FOR SALE  

Tools  

API  

Store  

Statistics  

Search:  
  
(domain, ip, ASN or company name)
 

EN   |  RU  

  Your ip: 18.205.60.226      MIT     AS14618     
United States  
  Details...    Login    186 

Domains in block
216.36.192.0 - 216.36.255.255

Net block: 216.36.192.0 - 216.36.255.255
Block name: HOSTWAY-04
Block size:16384
Organization: Hostway Corporation
Parent block: 216.0.0.0-216.255.255.255
US, United States, Chicago
               
N ip domain web server powered by host name updated
1216.36.192.20 Favicon icon
id84.securedata.net 
_ id84.securedata.net 2015-11-14
2216.36.193.116 Favicon icon
chandlerpolice.com 
_ chandlerpd.com 2015-12-02
3216.36.193.116 Favicon icon
chandlerpolice.net 
_ chandlerpd.com 2016-01-25
4216.36.193.116 Favicon icon
chandlerpolice.org 
_ chandlerpd.com 2015-11-14
5216.36.195.20 Favicon icon
mail.professionalassociatespublishing.com 
2016-09-05
6216.36.196.128 Favicon icon
biz101.com 
_ no record 2015-12-02
7216.36.196.128 Favicon icon
mail.biz101.com 
_ no record 2016-09-05
8216.36.196.187 Favicon icon
id85.securedata.net 
_ id85.securedata.net 2015-11-14
9216.36.197.222 Favicon icon
resourceequipmentco.com 
_ no record 2015-12-02
10216.36.199.136 Favicon icon
mail.roguesjournal.com 
_ no record 2016-03-08
11216.36.199.136 Favicon icon
roguesjournal.com 
_ no record 2015-12-02
12216.36.199.147 Favicon icon
trilliumshilohs.com 
_ shilohshepherds.com 2016-01-25
13216.36.199.198 Favicon icon
banthatracks.com 
_ no record 2016-01-25
14216.36.199.198 Favicon icon
mail.banthatracks.com 
_ no record 2016-03-08
15216.36.199.198 Favicon icon
www.banthatracks.com 
_ no record 2016-01-25
16216.36.200.77 Favicon icon
55.securedata.net 
_ 55.securedata.net 2015-11-14
17216.36.200.143 Favicon icon
volano.siteprotect.com 
_ volano.siteprotect.com 2015-11-14
18216.36.202.88 Favicon icon
id26.securedata.net 
_ id26.securedata.net 2015-11-14
19216.36.202.158 Favicon icon
mail.rclawfirm.com 
_ no record 2016-09-05
20216.36.202.158 Favicon icon
rclawfirm.com 
_ no record 2015-12-02
21216.36.202.217 Favicon icon
kreaturae.com 
_ no record 2015-12-02
22216.36.202.217 Favicon icon
mail.kreaturae.com 
_ no record 2016-09-05
23216.36.203.42 Favicon icon
5thportal.com 
_ no record 2015-12-02
24216.36.203.42 Favicon icon
mail.5thportal.com 
_ no record 2016-09-05
25216.36.204.11 Favicon icon
mail.patisant.com 
_ patisant.com 2016-03-08
26216.36.204.11 Favicon icon
patisant.com 
_ patisant.com 2015-12-02
27216.36.204.146 Favicon icon
comicdatabase.com 
_ no record 2015-12-02
28216.36.204.146 Favicon icon
mail.comicdatabase.com 
_ no record 2016-03-08
29216.36.206.54 Favicon icon
mail.mccainmea.com 
_ mccainmea.com 2016-09-05
30216.36.206.54 Favicon icon
mccainmea.com 
_ mccainmea.com 2015-12-02
31216.36.206.67 Favicon icon
cal-online.ws 
_ no record 2016-02-17
32216.36.206.67 Favicon icon
mail.cal-online.ws 
_ no record 2016-09-05
33216.36.206.128 Favicon icon
distinctivepromotion.com 
_ distinctivepromotions.com 2016-01-25
34216.36.206.132 Favicon icon
beyondthevote.com 
_ no record 2015-12-02
35216.36.206.132 Favicon icon
mail.beyondthevote.com 
_ no record 2016-03-08
36216.36.207.201 Favicon icon
mail.ontwerpers.info 
_ no record 2016-03-08
37216.36.207.201 Favicon icon
ontwerpers.info 
_ no record 2016-01-25
38216.36.208.28 Favicon icon
mansfieldequip.hostway.com 
_ mansfieldequip.hostway.com 2015-11-14
39216.36.208.66 Favicon icon
mail.searchbusters.com 
_ no record 2016-09-05
40216.36.208.66 Favicon icon
searchbusters.com 
_ no record 2015-12-02
41216.36.208.194 Favicon icon
esprint.com.ph 
_ no record 2015-11-14
42216.36.208.194 Favicon icon
mail.esprint.com.ph 
_ no record 2016-02-17
43216.36.210.27 Favicon icon
mail.totalparts.cc 
_ totalparts.cc 2016-02-17
44216.36.210.27 Favicon icon
totalparts.cc 
_ totalparts.cc 2015-11-14
45216.36.210.101 Favicon icon
gastric-bypass.net 
_ no record 2016-01-25
46216.36.210.101 Favicon icon
gastricbypass.net 
_ no record 2016-01-25
47216.36.210.168 Favicon icon
id29.securedata.net 
_ id29.securedata.net 2015-11-14
48216.36.210.169 Favicon icon
echecksnow.com 
_ no record 2015-10-16
49216.36.210.248 Favicon icon
onestopscreensavers.com 
_ no record 2015-12-02
50216.36.211.34 Favicon icon
hairlosstalk.org 
_ no record 2015-12-02
51216.36.211.34 Favicon icon
mail.hairlosstalk.org 
_ no record 2016-09-05
52216.36.212.241 Favicon icon
dcheung.com 
_ no record 2016-01-25
53216.36.212.241 Favicon icon
dylancheung.com 
_ no record 2016-01-25
54216.36.212.241 Favicon icon
k-cheung.com 
_ no record 2015-12-02
55216.36.212.241 Favicon icon
kellycheung.com 
_ no record 2015-12-02
56216.36.212.241 Favicon icon
l-cheung.com 
_ no record 2015-12-02
57216.36.212.241 Favicon icon
lokcheung.com 
_ no record 2015-12-02
58216.36.212.241 Favicon icon
suzannacheung.com 
_ no record 2015-12-02
59216.36.212.241 Favicon icon
tylercheung.com 
_ no record 2015-12-02
60216.36.212.241 Favicon icon
www.dcheung.com 
_ no record 2016-01-25
61216.36.212.241 Favicon icon
www.dylancheung.com 
_ no record 2016-01-25
62216.36.213.132 Favicon icon
homesellerreports.com 
_ homebuyerreports.com 2015-12-02
63216.36.214.223 Favicon icon
buriedinthedesert.com 
_ no record 2015-12-02
64216.36.214.223 Favicon icon
desertflower.org 
_ no record 2015-12-02
65216.36.214.223 Favicon icon
goatoporno.com 
_ no record 2015-12-02
66216.36.214.223 Favicon icon
ratwater.org 
_ no record 2015-12-02
67216.36.214.223 Favicon icon
student-voice.org 
_ no record 2015-12-02
68216.36.215.222 Favicon icon
newsletterbroadcast01.siteprotect.com 
_ newsletterbroadcast01.siteprotect.com 2015-11-14
69216.36.215.233 Favicon icon
virgo3.siteprotect.com 
_ virgo3.siteprotect.com 2015-11-14
70216.36.217.109 Favicon icon
onestopictures.com 
_ onestoppictures.com 2015-12-02
71216.36.217.183 Favicon icon
alagna.org 
_ no record 2015-12-02
72216.36.217.183 Favicon icon
mail.alagna.org 
_ no record 2016-09-05
73216.36.217.183 Favicon icon
www.alagna.org 
_ no record 2015-11-14
74216.36.217.233 Favicon icon
virgo4.siteprotect.com 
_ virgo4.siteprotect.com 2015-11-14
75216.36.219.14 Favicon icon
reaction.westmonroepartners.com 
Microsoft-IIS/7.5  
ASP.NET no record 2015-11-14
76216.36.219.37 Favicon icon
mosaicconsultants.com 
Microsoft-IIS/7.0  
ASP.NET no record 2015-12-02
77216.36.219.37 Favicon icon
project.westmonroepartners.com 
Microsoft-IIS/7.0  
ASP.NET no record 2015-11-14
78216.36.219.37 Favicon icon
qa.westmonroepartners.com 
Microsoft-IIS/7.0  
ASP.NET no record 2015-11-14
79216.36.219.37 Favicon icon
westmonroepartners.net 
Microsoft-IIS/7.0  
ASP.NET no record 2016-01-25
80216.36.219.37 Favicon icon
wiredmatrix.com 
Microsoft-IIS/7.0  
ASP.NET no record 2015-12-02
81216.36.219.37 Favicon icon
wmp1.com 
Microsoft-IIS/7.0  
ASP.NET no record 2015-12-02
82216.36.219.37 Favicon icon
wmpone.com 
Microsoft-IIS/7.0  
ASP.NET no record 2015-12-02
83216.36.219.40 Favicon icon
flexdls.com 
Microsoft-IIS/7.0  
ASP.NET no record 2016-01-25
84216.36.219.40 Favicon icon
forums.westmonroepartners.com 
Microsoft-IIS/7.0  
ASP.NET no record 2015-11-14
85216.36.219.40 Favicon icon
issues.westmonroepartners.com 
Microsoft-IIS/7.0  
ASP.NET no record 2015-11-14
86216.36.219.40 Favicon icon
support.westmonroepartners.com 
Microsoft-IIS/7.0  
ASP.NET no record 2015-11-14
87216.36.219.40 Favicon icon
wiki.westmonroepartners.com 
Microsoft-IIS/7.0  
ASP.NET no record 2015-11-14
88216.36.219.40 Favicon icon
www.flexdls.com 
Microsoft-IIS/7.0  
ASP.NET no record 2016-01-25
89216.36.219.72 Favicon icon
reunioncommunications.com 
_ no record 2015-12-02
90216.36.219.72 Favicon icon
reuniontelecom.info 
_ no record 2016-01-25
91216.36.219.137 Favicon icon
atpropertiesrelocation.com 
_ atpropertiesecard.com 2015-12-02
92216.36.219.137 Favicon icon
tinyatp.net 
_ atpropertiesecard.com 2016-01-25
93216.36.219.196 Favicon icon
mail.cloudal.com 
Microsoft-IIS/7.0  
ASP.NET mail.cloudal.com 2015-11-14
94216.36.219.197 Favicon icon
alohahappyhour.com 
Microsoft-HTTPAPI/2.0  
no record 2015-12-02
95216.36.219.197 Favicon icon
alohatennis.com 
Microsoft-HTTPAPI/2.0  
no record 2015-12-02
96216.36.219.197 Favicon icon
gotwhales.com 
Microsoft-HTTPAPI/2.0  
no record 2015-12-02
97216.36.219.197 Favicon icon
livestockshare.com 
Microsoft-HTTPAPI/2.0  
no record 2015-12-02
98216.36.219.197 Favicon icon
lyonglass.net 
Microsoft-HTTPAPI/2.0  
no record 2016-01-25
99216.36.219.197 Favicon icon
makenatennis.com 
Microsoft-HTTPAPI/2.0  
no record 2015-12-02
100216.36.219.197 Favicon icon
mauihappyhour.com 
Microsoft-HTTPAPI/2.0  
no record 2015-12-02
101216.36.219.197 Favicon icon
mauileasales.com 
Microsoft-HTTPAPI/2.0  
no record 2015-12-02
102216.36.219.197 Favicon icon
mauipersonaltrainer.com 
Microsoft-HTTPAPI/2.0  
no record 2015-12-02
103216.36.219.197 Favicon icon
mauisharks.com 
Microsoft-HTTPAPI/2.0  
no record 2015-12-02
104216.36.219.197 Favicon icon
shydoggy.com 
Microsoft-HTTPAPI/2.0  
no record 2015-12-02
105216.36.219.197 Favicon icon
stevenkatch.com 
Microsoft-HTTPAPI/2.0  
no record 2015-12-02
106216.36.219.197 Favicon icon
tradethebuzz.com 
Microsoft-HTTPAPI/2.0  
no record 2015-12-02
107216.36.219.216 Favicon icon
globalipweb.com 
Microsoft-IIS/7.5  
ASP.NET no record 2015-11-14
108216.36.219.221 Favicon icon
directoryip.com 
Microsoft-IIS/7.5  
ASP.NET no record 2015-11-14
109216.36.219.221 Favicon icon
portfoliocosts.com 
Microsoft-IIS/7.5  
ASP.NET no record 2015-11-14
110216.36.219.221 Favicon icon
www.directoryip.com 
Microsoft-IIS/7.5  
ASP.NET no record 2016-01-25
111216.36.220.2 Favicon icon
mail.billtwells.com 
_ wtf311.chi.us.siteprotect.com 2016-03-08
112216.36.220.2 Favicon icon
mail.carlsonanddeklerk.com 
_ wtf311.chi.us.siteprotect.com 2016-09-05
113216.36.220.2 Favicon icon
mail.mtmlegal.com 
_ wtf311.chi.us.siteprotect.com 2015-11-14
114216.36.220.2 Favicon icon
mail2.kyautoaccidentattorney.com 
_ wtf311.chi.us.siteprotect.com 2017-03-14
115216.36.220.2 Favicon icon
mail2.longislanddefensefirm.com 
_ wtf311.chi.us.siteprotect.com 2016-09-05
116216.36.220.3 Favicon icon
carlsonanddeklerk.com 
_ wtf312.chi.us.siteprotect.com 2015-12-02
117216.36.220.3 Favicon icon
colony54.com 
_ wtf312.chi.us.siteprotect.com 2015-12-02
118216.36.220.3 Favicon icon
criminaldefendernyc.com 
_ wtf312.chi.us.siteprotect.com 2015-12-02
119216.36.220.3 Favicon icon
findacriminaldefenselawyer.com 
_ wtf312.chi.us.siteprotect.com 2015-12-02
120216.36.220.3 Favicon icon
findafamilylawyer.com 
_ wtf312.chi.us.siteprotect.com 2015-12-02
121216.36.220.3 Favicon icon
findahairsalon.com 
_ wtf312.chi.us.siteprotect.com 2015-12-02
122216.36.220.3 Favicon icon
findalocalappraiser.com 
_ wtf312.chi.us.siteprotect.com 2015-12-02
123216.36.220.3 Favicon icon
findalocalcosmeticdentist.com 
_ wtf312.chi.us.siteprotect.com 2015-12-02
124216.36.220.3 Favicon icon
findalocalcpa.com 
_ wtf312.chi.us.siteprotect.com 2015-12-02
125216.36.220.3 Favicon icon
findalocaldayspa.com 
_ wtf312.chi.us.siteprotect.com 2015-12-02
126216.36.220.3 Favicon icon
findalocalnotary.com 
_ wtf312.chi.us.siteprotect.com 2015-12-02
127216.36.220.3 Favicon icon
findamedicalmalpracticelawyer.com 
_ wtf312.chi.us.siteprotect.com 2015-12-02
128216.36.220.3 Favicon icon
findanetworkadmin.com 
_ wtf312.chi.us.siteprotect.com 2015-12-02
129216.36.220.3 Favicon icon
findanimmigrationlawyer.com 
_ wtf312.chi.us.siteprotect.com 2015-12-02
130216.36.220.3 Favicon icon
findanipattorney.com 
_ wtf312.chi.us.siteprotect.com 2015-12-02
131216.36.220.3 Favicon icon
findapersonalinjurylawyer.com 
_ wtf312.chi.us.siteprotect.com 2015-12-02
132216.36.220.3 Favicon icon
findarealestatelawyer.com 
_ wtf312.chi.us.siteprotect.com 2015-12-02
133216.36.220.3 Favicon icon
findyourcosmeticsurgeon.com 
_ wtf312.chi.us.siteprotect.com 2016-01-25
134216.36.220.3 Favicon icon
findyourflowershop.com 
_ wtf312.chi.us.siteprotect.com 2016-01-25
135216.36.220.3 Favicon icon
lawyervioxx.com 
_ wtf312.chi.us.siteprotect.com 2015-12-02
136216.36.220.3 Favicon icon
mail.findanetworkadmin.com 
_ wtf312.chi.us.siteprotect.com 2016-09-05
137216.36.220.3 Favicon icon
plasticsurgeonburbank.com 
_ wtf312.chi.us.siteprotect.com 2015-12-02
138216.36.220.3 Favicon icon
scorpionaccountant.com 
_ wtf312.chi.us.siteprotect.com 2015-12-02
139216.36.220.3 Favicon icon
www.findyourcosmeticsurgeon.com 
_ wtf312.chi.us.siteprotect.com 2016-01-25
140216.36.220.3 Favicon icon
www.findyourflowershop.com 
_ wtf312.chi.us.siteprotect.com 2016-01-25
141216.36.220.3 Favicon icon
yourhoustoncpa.com 
_ wtf312.chi.us.siteprotect.com 2015-12-02
142216.36.220.6 Favicon icon
mail.findahairsalon.com 
2016-09-05
143216.36.220.6 Favicon icon
mail.oaklandcountyfamilylawyer.com 
2016-03-08
144216.36.220.6 Favicon icon
mail.scorpiondirectories.com 
2016-09-05
145216.36.220.23 Favicon icon
cardiinternational.com 
Microsoft-IIS/7.5  
ASP.NET wtf390.chi.us.siteprotect.com 2015-12-02
146216.36.220.23 Favicon icon
www.cardiinternational.com 
Microsoft-IIS/7.5  
ASP.NET wtf390.chi.us.siteprotect.com 2015-12-02
147216.36.220.25 Favicon icon
blacktie.com 
Microsoft-IIS/7.5  
ASP.NET no record 2015-12-02
148216.36.220.25 Favicon icon
railtransload.com 
Microsoft-IIS/7.5  
ASP.NET no record 2015-12-02
149216.36.220.25 Favicon icon
www.blacktie.com 
Microsoft-IIS/7.5  
ASP.NET no record 2015-12-02
150216.36.220.29 Favicon icon
mail.anasys-apr.com 
Microsoft-IIS/8.0  
ASP.NET wtf396.chi.us.siteprotect.com 2016-09-05
151216.36.220.30 Favicon icon
algotrd.com 
Apache/2.4.9 (Win32) OpenSSL/1.0.1g PHP/5.5.11  
wtf393.chi.us.siteprotect.com 2015-11-14
152216.36.220.34 Favicon icon
pac1944.org 
Microsoft-IIS/8.5  
wtf395.chi.us.siteprotect.com 2015-11-14
153216.36.220.34 Favicon icon
pna-znp.org 
Microsoft-IIS/8.5  
wtf395.chi.us.siteprotect.com 2015-11-14
154216.36.220.34 Favicon icon
pnareps.org 
Microsoft-IIS/8.5  
wtf395.chi.us.siteprotect.com 2015-11-14
155216.36.220.34 Favicon icon
unionofpoles.com 
Microsoft-IIS/8.5  
wtf395.chi.us.siteprotect.com 2015-11-14
156216.36.220.34 Favicon icon
www.pac1944.org 
Microsoft-IIS/8.5  
wtf395.chi.us.siteprotect.com 2016-01-25
157216.36.220.34 Favicon icon
www.pnareps.org 
Microsoft-IIS/8.5  
wtf395.chi.us.siteprotect.com 2015-11-14
158216.36.220.37 Favicon icon
ftp.calculated.com 
Microsoft-IIS/8.0  
ASP.NET wtf397.chi.us.siteprotect.com 2015-11-14
159216.36.220.40 Favicon icon
155northwacker.com 
_ no record 2015-12-02
160216.36.220.40 Favicon icon
155nwacker.com 
_ no record 2015-12-02
161216.36.220.40 Favicon icon
jamintelligence.com 
_ no record 2015-12-02
162216.36.220.59 Favicon icon
grupotaca.com 
_ wtf352.chi.us.siteprotect.com 2015-12-02
163216.36.220.59 Favicon icon
tacaairlines.com 
_ wtf352.chi.us.siteprotect.com 2015-12-02
164216.36.220.59 Favicon icon
www.grupotaca.com 
_ wtf352.chi.us.siteprotect.com 2016-01-25
165216.36.220.78 Favicon icon
images.csntm.org 
Microsoft-IIS/7.5  
ASP.NET wtf367.chi.us.siteprotect.com 2015-11-14
166216.36.220.79 Favicon icon
ameradnan.com 
Microsoft-IIS/7.5  
ASP.NET wtf368.chi.us.siteprotect.com 2015-12-02
167216.36.220.79 Favicon icon
development.maavratech.com 
Microsoft-IIS/7.5  
ASP.NET wtf368.chi.us.siteprotect.com 2015-11-14
168216.36.220.79 Favicon icon
liveadmins.ae 
Microsoft-IIS/7.5  
ASP.NET wtf368.chi.us.siteprotect.com 2015-12-02
169216.36.220.79 Favicon icon
maavratech.com 
Microsoft-IIS/7.5  
ASP.NET wtf368.chi.us.siteprotect.com 2015-12-02
170216.36.220.79 Favicon icon
mychatsoftware.com 
Microsoft-IIS/7.5  
ASP.NET wtf368.chi.us.siteprotect.com 2015-12-02
171216.36.220.79 Favicon icon
mylivechatsoftware.com 
Microsoft-IIS/7.5  
ASP.NET wtf368.chi.us.siteprotect.com 2015-12-02
172216.36.220.79 Favicon icon
wglivechatsoftware.com 
Microsoft-IIS/7.5  
ASP.NET wtf368.chi.us.siteprotect.com 2015-12-02
173216.36.220.79 Favicon icon
wgwebsolutions.com 
Microsoft-IIS/7.5  
ASP.NET wtf368.chi.us.siteprotect.com 2015-12-02
174216.36.220.79 Favicon icon
www.ameradnan.com 
Microsoft-IIS/7.5  
ASP.NET wtf368.chi.us.siteprotect.com 2015-12-02
175216.36.220.79 Favicon icon
www.liveadmins.ae 
Microsoft-IIS/7.5  
ASP.NET wtf368.chi.us.siteprotect.com 2016-01-25
176216.36.220.161 Favicon icon
mail.jamminjim.com 
2016-03-08
177216.36.220.210 Favicon icon
wtf36.chi.us.siteprotect.com 
Microsoft-IIS/7.5  
ASP.NET wtf36.chi.us.siteprotect.com 2015-11-14
178216.36.221.3 Favicon icon
shitsumonsho.com 
Microsoft-IIS/6.0  
ASP.NET no record 2015-12-02
179216.36.221.3 Favicon icon
www.shitsumonsho.com 
Microsoft-IIS/6.0  
ASP.NET no record 2015-11-14
180216.36.221.4 Favicon icon
www.nolit.com.mx 
Microsoft-IIS/6.0  
ASP.NET no record 2015-11-17
181216.36.221.5 Favicon icon
pratt-hobbies.com 
Microsoft-IIS/6.0  
ASP.NET no record 2015-11-14
182216.36.221.5 Favicon icon
www.pratt-hobbies.com 
Microsoft-IIS/6.0  
ASP.NET no record 2015-11-14
183216.36.221.7 Favicon icon
flexcloud-drive.com 
Microsoft-IIS/6.0  
ASP.NET no record 2016-01-25
184216.36.221.7 Favicon icon
www.flexcloud-drive.com 
Microsoft-IIS/6.0  
ASP.NET no record 2016-01-25
185216.36.221.8 Favicon icon
flexcloud-backup.com 
Microsoft-IIS/6.0  
ASP.NET no record 2016-01-25
186216.36.221.8 Favicon icon
www.flexcloud-backup.com 
Microsoft-IIS/6.0  
ASP.NET no record 2016-01-25
187216.36.221.12 Favicon icon
exploresalalah.com 
Microsoft-IIS/6.0  
ASP.NET no record 2015-11-14
188216.36.221.13 Favicon icon
accutact.com 
Microsoft-IIS/6.0  
ASP.NET no record 2015-12-02
189216.36.221.13 Favicon icon
www.accutact.com 
Microsoft-IIS/6.0  
ASP.NET no record 2015-12-02
190216.36.221.14 Favicon icon
communitybankers.us 
_ no record 2015-12-02
191216.36.221.17 Favicon icon
dahliablu.com 
Microsoft-IIS/6.0  
ASP.NET no record 2015-12-02
192216.36.221.18 Favicon icon
fercalt.gov 
Microsoft-IIS/6.0  
ASP.NET no record 2015-12-02
193216.36.221.19 Favicon icon
wilmawear.com 
Microsoft-IIS/6.0  
ASP.NET no record 2016-01-25
194216.36.221.19 Favicon icon
www.wilmawear.com 
Microsoft-IIS/6.0  
ASP.NET no record 2016-01-25
195216.36.221.20 Favicon icon
daymakers.com 
Microsoft-IIS/6.0  
ASP.NET no record 2016-01-25
196216.36.221.20 Favicon icon
www.daymakers.com 
Microsoft-IIS/6.0  
ASP.NET no record 2016-01-25
197216.36.221.22 Favicon icon
tax-usa.net 
Microsoft-IIS/6.0  
ASP.NET no record 2015-12-02
198216.36.221.22 Favicon icon
www.tax-usa.net 
Microsoft-IIS/6.0  
ASP.NET no record 2016-01-25
199216.36.221.25 Favicon icon
hadley.edu 
Microsoft-IIS/6.0  
ASP.NET no record 2017-08-07
200216.36.221.25 Favicon icon
www.hadley-school.org 
Microsoft-IIS/6.0  
ASP.NET no record 2015-11-14
Next page