Logo  

IPv4info  

Tools  

API  

Store  

Statistics  

Search:  
  
(domain, ip, ASN or company name)
 

EN   |  RU  

  Your ip: 54.82.119.116      AMAZON-2011L     AS14618     
United States  
  Details...    Login    109 


DNS server dns.trouble-free.net

ip address:66.45.228.79
number of zones:6411
primary zones:6177
secondary zones:199
unknown:35


Zone list.

N zone type N zone type
100359.euprimary 20to60.orgprimary
31-salarysurveys.comsecondary 410-k.bizprimary
5100balloons.comprimary 6100gruz.comprimary
7100vesov.com.uaprimary 8100vesov.comprimary
9100vesov.dp.uaprimary 10101downloadgames4pc.comprimary
11101googleadsense.comprimary 12101moneymakingtips.comprimary
13101sextips.orgprimary 14105kvadratov.comprimary
1510millionvisitors.netprimary 16113online.frprimary
1711proxy.casaprimary 18123proxy.xyzprimary
191cooldad.comprimary 201mapk.netprimary
211network.spaceprimary 221stmi.comprimary
231stopitdept.comprimary 242-auto.comprimary
252012smartphones.comprimary 262013camera.comprimary
272013laptop.comprimary 282013phones.comprimary
292013smartphones.comprimary 302013tablet.comprimary
312014laptop.comprimary 322014newcar.comprimary
332014phones.comprimary 342014tablet.comprimary
352015celebritydeaths.comprimary 362015laptop.comprimary
372015phones.comprimary 382015smartphones.comprimary
392015tablet.comprimary 402016laptop.comprimary
412016phones.comprimary 422016smartphones.comprimary
432016tablet.comprimary 4421denovembro.comprimary
4521filme.comprimary 4621idcpk.comprimary
47234forum.comprimary 4824-7claim.co.ukprimary
49247adnetwork.comprimary 5025hundreddollarlisting.comprimary
512gsm.usprimary 52330-282-7193.xyzprimary
53361.ptprimary 54365joursenaustralie.frprimary
5538stroika.ruprimary 5638strouka.ruprimary
57390tech.comprimary 583gmobile.bizprimary
593shost.comprimary 603slsa.comprimary
613techmarketing.comprimary 623tut.comprimary
6340070.orgprimary 64401usa.comprimary
654do.orgprimary 664torres.peprimary
675core.inprimary 685homesforsale.comprimary
695starsjewelry.comprimary 70720movie.xyzprimary
7185us.comprimary 72878studio.comprimary
738ametit.eeprimary 74aaabadhukyatya.comprimary
75aaabadukadamelatulya.comprimary 76aaabakalmeisath.comprimary
77aaabdimemageba.comprimary 78aaabhyukirlaviswa.comprimary
79aaalukachalubeta.comprimary 80aaamdukakakaki.comprimary
81aaarelocation.netprimary 82aaatumanebhagwan.comprimary
83aabadhukyaresuthayy.comprimary 84aabdukandigenfa.comprimary
85aabubhebhanatha.comprimary 86aabukandananda.comprimary
87aadukachalubeta.comprimary 88aavaydayinakarbaka.comprimary
89abailable.workprimary 90abboniss.comprimary
91abbottwellness.casecondary 92abcpartyideasforgirls.orgprimary
93abcsoftperu.comprimary 94abetukyacheaav.comprimary
95abetukyajayche.comprimary 96abexercisesforwomen.netprimary
97aboutdomains.netprimary 98absentmuse.comprimary
99absinthe-literary-review.comprimary 100absolutelytrue.comprimary
101absolutevips.comprimary 102abstractdirectory.netprimary
103abtmax.comprimary 104academywebspecialists.comprimary
105acadia-cottage.comprimary 106acadia-cottages.comprimary
107acadiacabin.comprimary 108acadiacabins.comprimary
109acceauto.comprimary 110accentureindia.inprimary
111accfunding.comprimary 112accommodation-bali-villas.comprimary
113account-issued.infoprimary 114accountingassignmenthelp.netprimary
115accragossips.comprimary 116acehmajakani.comprimary
117aceslong.comprimary 118acesolos.comprimary
119acnd.netprimary 120actjet.orgprimary
121actor69.comprimary 122actorstemping.comprimary
123actortemp.usprimary 124acttoneducation.comprimary
125actualidaddenoticias.comprimary 126acutt.euprimary
127ad4bd.comprimary 128adamsproductionservices.comprimary
129adamsrentalsllc.comprimary 130adbeammedia.comprimary
131addictedtomusclebuilding.comprimary 132addlocallisting.comprimary
133addperclick.comprimary 134adeoba.comprimary
135adessodesign.caprimary 136adias-place.comprimary
137adias.placeprimary 138adimaz.comprimary
139adiosespana.comprimary 140adisjugo.netprimary
141adityabdhende.comprimary 142adminsl.comprimary
143adorobundas.comprimary 144adorocoroas.comprimary
145adprojobs.comprimary 146adrianabucevschi.roprimary
147adscluster.comprimary 148adsmoney.workprimary
149adsoftpro.comprimary 150adswikia.netprimary
151aduani.comprimary 152adult-tube-empire.comprimary
153adultdayservicesinc.comprimary 154adultsexxxporn.comprimary
155adultwebdirect.comprimary 156adventurecampcolorado.orgunknown
157adventuregamespa.comprimary 158adverdized.comprimary
159adviseblog.inprimary 160adviseinsurance.comprimary
161advjee.infoprimary 162adwordsdesk.comprimary
163aeonizm.netprimary 164af1.coprimary
165affordablepackageholidays.co.ukprimary 166affordableseo.xyzprimary
167afgreet.comprimary 168afholding.comprimary
169afiliadoderesultado.comprimary 170afilmstory.comprimary
171afonso.xyzprimary 172agabaihomezpro.comprimary
173agadnivatpachi.comprimary 174ageinmotion.comprimary
175agenciadehoteles.comprimary 176agenglucolamci.comprimary
177agilangedi.comprimary 178agriptoshafts.comprimary
179agronoor.comprimary 180agrosechura.com.peprimary
181ahkabbara.comprimary 182ahlehaqmedia.comprimary
183aiaao-bar.orgprimary 184aijubanews.comprimary
185aim.kzprimary 186aimfitsoul.comprimary
187aionexposed.designprimary 188aionplaschamois.comprimary
189air-jordan-11.comprimary 190air-purifiers.casaprimary
191airconditioners.casaprimary 192airebarcelonadf.comprimary
193airics.comprimary 194airingtoday.netprimary
195airline-flight.co.ukprimary 196airlinefares.co.ukprimary
197airmax90.netprimary 198airoceanline.comprimary
199airstreamengenharia.comprimary 200airtech-inflables.comprimary
201airtech-inflatable.comprimary 202airtraveldiscountz.comprimary
203airvoicetechsupport.comprimary 204aisonc.xyzprimary
205ajayrahomera.comprimary 206ajittiwari.orgprimary
207ajloans.comprimary 208ajuniverse4u.comprimary
209akeso.inprimary 210akesohairtransplant.comprimary
211akhbarassabah.comprimary 212akhbarsouk.comprimary
213akmal.web.idprimary 214akmal.workprimary
215akmalmp3.xyzprimary 216akmalsw.workprimary
217akshaybhatt24.comprimary 218al-alam.netprimary
219al-musafiroun.comprimary 220al-saleem.netprimary
221alaa-al.comprimary 222alamkerjaya.comprimary
223alamn.netprimary 224alarmingsigns.comprimary
225alaska-island-property.comprimary 226alavideochatclub.comprimary
227albaariq.comprimary 228albahjahindramayu.comprimary
229albecoperu.comprimary 230albioncapitalllc.comprimary
231albishtawi.comprimary 232alc.com.uaprimary
233aleab.comprimary 234alex-today.comprimary
235alexalonso.comprimary 236alexalonso.netprimary
237alexalonso.orgprimary 238alexnbeclub.comprimary
239alexretivov.comprimary 240alghofaili.comprimary
241alhazred.comprimary 242alhodhud.comprimary
243alhudaploso.orgprimary 244aliancaline.comprimary
245aliciatop.comprimary 246alihairextensions.comprimary
247alimian.comprimary 248alinaerika.comprimary
249alislamschool.comprimary 250alittle.workprimary
251alkhayrat.orgprimary 252all-laptop-repair.comprimary
253allaboutthegarden.comsecondary 254allahuakbarradio.comprimary
255allbookson.comsecondary 256allegrointegrated.comprimary
257allinclusivevacationsabc.xyzprimary 258allindiamedia.comprimary
259allisod.comprimary 260allmesotheliomanews.comprimary
261allmp3online.xyzprimary 262allnewmp3songs.comprimary
263allodop.frprimary 264allonsdanser.orgprimary
265allowmelbk.comprimary 266allowmelubbock.comprimary
267allritehomezworkez.comprimary 268allsell.topprimary
269allthatmail.comprimary 270allthatmail.netprimary
271allthedog.comprimary 272alltopfives.comprimary
273alltransdz.comprimary 274almohsen-group.comprimary
275alonsosantamaria.comprimary 276alore-accessories.comprimary
277alshamsi.netprimary 278altaimagenperu.comprimary
279alternativecruisers.comprimary 280alutemp.comprimary
281alwadifapress.comprimary 282alyssallure.comprimary
283alyssasellors.comprimary 284alzahraagroup-eg.comprimary
285alzatech.comprimary 286alzghaibi.comprimary
287amadukakanabapp.comprimary 288amalfi-villas.comprimary
289amarillohomebuyers.comprimary 290amarinotportfolio.frprimary
291amateursex100.comprimary 292amatisdesign.comprimary
293amazingshop24.comprimary 294amazingsportsvideos.comprimary
295amazonuniquewebstores.comprimary 296ambanigeracanada.caprimary
297ambematatameaavo.comprimary 298ambientalbmrs.orgprimary
299ambitioncentre.comprimary 300amblerfest.comprimary
301amblerrotary.orgprimary 302ameerpetlo.comprimary
303amensbd.comprimary 304america.aiprimary
305americantravel.centerprimary 306amgacademia.com.uyprimary
307amigodigitalmedia.comprimary 308amournaija.comprimary
309amrudtuttifrutti.comprimary 310amuthu.tkprimary
311amziya.comprimary 312analima.ninjaprimary
313analytricks.comprimary 314anandah.comprimary
315anantra.grprimary 316anchorageglass.comprimary
317andoigaming.xyzprimary 318andreaclut.comprimary
319andrewratshin.comprimary 320androidhouse.infoprimary
321androidnetwork.infoprimary 322androidphonesz.comprimary
323androidrisks.comprimary 324androidsphere.comprimary
325androidterbaru.xyzprimary 326andropedia.infoprimary
327androstock.comprimary 328andyostrowitz.comprimary
329anezs.comprimary 330angeethiva.comprimary
331angelatrishapsychicuk.comprimary 332anggimetra.infoprimary
333angkringanweb.comprimary 334anglesearidingclub.comprimary
335anguilla-ai.comprimary 336angular.grprimary
337angular.systemsprimary 338animadoracarlapalacios.comprimary
339aniva-int.comprimary 340aniva-international.comprimary
341aniva-pharma.comprimary 342anivagene.comprimary
343annabaservices.comprimary 344annafm.comprimary
345annapolisbakery.comprimary 346annhanh.comprimary
347anonimocaerus.xyzprimary 348anonimous.xyzprimary
349anonimousgroup.xyzprimary 350anscompany.inprimary
351anshumanbittharia.comprimary 352anthonet.grprimary
353anthrogenica.comprimary 354antirox.comprimary
355antirox.orgprimary 356antoninorestuccia.comprimary
357antrimweb.comprimary 358anunciaeninternet.comprimary
359anuragbhardwaj.usprimary 360aoforklift.comprimary
361aogasociados.comsecondary 362ap-solar.comprimary
363aparatosman.comprimary 364aparawa.comprimary
365aparnakk.comprimary 366apartmentdesigning.comprimary
367apekk.ussecondary 368apekkintl.comprimary
369aphadministradores.comsecondary 370apkzone.orgprimary
371aplusthemes.comprimary 372aponjonbhromon.comprimary
373appartist.orgprimary 374appdesktechnologies.comprimary
375appforpconline.comprimary 376appinessh.comprimary
377appletoandroid.comprimary 378appliancesbox.comprimary
379apploud.inprimary 380appmakerproducts.comprimary
381appomattoxchurchofchrist.orgprimary 382apps-generator.comprimary
383appsandroidonline.comprimary 384appsburner.comprimary
385aprisun.frprimary 386aproxy.xyzprimary
387aptaceonline.comprimary 388aquaproxy.netprimary
389aquiculturaemfoco.comprimary 390ar-ua.comprimary
391araliyalanka.netprimary 392aramesh.usprimary
393aranock-online.comsecondary 394aratshin.comprimary
395arborplaceapartments.comprimary 396arborplaceapartments.netprimary
397arcadesource.comprimary 398arcangelsystem.netprimary
399archievemp3.comprimary 400arcintl.netprimary
401ardentsteel.comprimary 402arenton.comprimary
403arexperu.comprimary 404arganmadre.comprimary
405argon.com.uaprimary 406arie.xyzprimary
407arismovie.xyzprimary 408arlingtonmusicstudio.comprimary
409armpitpicture.comprimary 410aroque.comprimary
411aroqueathletic.comprimary 412arquitetosdavirtude.com.brprimary
413arras-online.frprimary 414arrosseriadefenals.comprimary
415arsamanggala.comprimary 416artaqua.coprimary
417artbudproekt.pp.uaprimary 418artcosm.comprimary
419artemelamina.comprimary 420artesdocirco.com.brprimary
421artisansinformatique.comprimary 422arts.aiprimary
423artsbygary.comsecondary 424arunkita.comprimary
425aryashi.comprimary 426asakkelaniya.comprimary
427asanahiyahawork.comprimary 428ascendingup.comprimary
429ascis--shoes.comprimary 430ascothomes.comprimary
431asdaaf.netprimary 432asesoriacontableperu.comprimary
433asesoriadetesislimaperu.comprimary 434asfalyadernegi.orgprimary
435asia-inter.comunknown 436asia.aiprimary
437asics--shoes.comprimary 438asicsgelkayano.comprimary
439askfreebie.comprimary 440askmrmoon.comprimary
441aspirationenergy.comprimary 442asproxy.casaprimary
443asrgroupcare.comprimary 444assambangaloreroadways.comprimary
445assamriflies.infoprimary 446associates-programs.comprimary
447associatesearch.comprimary 448associateshub.comprimary
449associationdes3lacs.caprimary 450assopnp.comprimary
451astrosdaily.comprimary 452ataudesecuador.comprimary
453atiradeonhd.comprimary 454atlantainsure.comprimary
455atlantajewellers.comprimary 456atlanticbizservices.comprimary
457atlantr.comprimary 458atlocksmith.nycprimary
459atnewsnviews.comprimary 460atriemg.com.brprimary
461au.aiprimary 462aubovan.infoprimary
463aunomdesfleurs.frprimary 464aushopclub.comprimary
465ausportstore.comprimary 466austinbridaljewelry.comprimary
467austinsportscars.comprimary 468austinweddingconsultant.comprimary
469ausunglass.comprimary 470auto2change.comsecondary
471autoavancer.comprimary 472autoclima.com.peprimary
473autodijagnostika.infoprimary 474autodoors.aeprimary
475autodsgn.comprimary 476autoinsurancerate.co.ukprimary
477automartdealers.comprimary 478automechanicusa.comprimary
479automecs.comprimary 480autoresponda.comprimary
481autos-cars.comprimary 482autosbolivia.comprimary
483autosbolivia.netprimary 484autosdeayer.comprimary
485autosmiami.netprimary 486autosnuevayork.comprimary
487autosuruguay.netprimary 488autosvenezuela.comprimary
489avanceydesarrollo.comprimary 490avenuebox.comprimary
491aviationalphabet.comprimary 492avilapaipilla.comprimary
493avjetbiotech.comprimary 494avlvzi.comprimary
495avsdesign.comprimary 496awakeningsfilm.comprimary
497awine.orgprimary 498axiumtechinc.comprimary
499aycmaqsac.comprimary 500ayo-download.comprimary
501ayudaproyecto.comprimary 502aywa.beprimary
503aztecainternacional.netprimary 504b7yls.comprimary
505babangida.comprimary 506babangkongan.workprimary
507babeenotes.comprimary 508babepal.comprimary
509baburamicrofinancebank.comprimary 510babyapsc.comprimary
511babyfacedcopy.comprimary 512babyria.comprimary
513babystroller.xyzprimary 514bacitv.comprimary
515backoffices.orgprimary 516badez.xyzprimary
517bagsfinder.comprimary 518baileywebmarketing.comprimary
519bairenmunihei.comprimary 520bajajequip.comprimary
521bajarpeliculagratis.comprimary 522bajukaosdistro.netprimary
523bala-designs.comprimary 524balcsik.comsecondary
525bali-beautiful-villas.comprimary 526bali-canggu-villas.comprimary
527bali-homes-villas.comprimary 528bali-massilia-villas.comprimary
529bali-seminyak-villas.comprimary 530bali-teresa-villas.comprimary
531bali-vacation-villas.comprimary 532balibeautifulvillas.comprimary
533balicangguvillas.comprimary 534balicarrental.co.idprimary
535balidestination.asiaprimary 536baliseminyakrentals.comprimary
537baliteresavillas.comprimary 538balivacationprivatevillas.comprimary
539balivillasinseminyak.netprimary 540balkan-team.comsecondary
541balkancommunity.infosecondary 542balloonworldny.comprimary
543baltimoreinsure.comprimary 544bambusanje.infoprimary
545bana.bizunknown 546bandwidthforum.comprimary
547bandwidthforums.comprimary 548banglachoti.clubprimary
549banglachotiall.comprimary 550banglachoticlub.comprimary
551banglachotii.comprimary 552bankruptcylawrequirements.netprimary
553bankruptcylawyerflorida.netprimary 554bannerdisplayadspro.comprimary
555baracear.comprimary 556barbaramorel.frprimary
557barbarascloset.comprimary 558barboxmusic.comprimary
559barclaytv.coprimary 560bargaincarhire.comprimary
561bargainsun.comprimary 562barileford.comprimary
563barmag-na.comprimary 564barshied.comprimary
565basededados.netprimary 566basingbusiness.comprimary
567batchsearch.comprimary 568batteryhydrometer.netprimary
569batuali.workprimary 570bavariauae.comprimary
571baylorstudios.comprimary 572bbwhub.netprimary
573bcctoys.comsecondary 574bcflooring.caprimary
575bchomeless.comprimary 576bcorx.casaprimary
577bcronline.netprimary 578bctherapists.comprimary
579bctherapists.orgprimary 580bdohome.comprimary
581beatsmonthly.comprimary 582beauty-nailsalon.netprimary
583beautyin2min.comprimary 584beautyqty.comprimary
585beautyskincaretips.orgprimary 586beautythroughcancer.orgprimary
587beautytoolsandaccessories.comprimary 588bedaksaripohatji.orgprimary
589bedlamradio.comprimary 590bedroomm.comprimary
591bedyatco.comunknown 592beervswine.frprimary
593befitequipment.comprimary 594beginneryoga.xyzprimary
595beginwithagrin.comprimary 596beheiralawyers.comprimary
597bekijkfilmsstreaming.infoprimary 598bekpekeran.comprimary
599belaruschurch.comprimary 600belidigital.comprimary
  Next page