Logo  

IPv4info  

Tools  

API  

Store  

Statistics  

Search:  
  
(domain, ip, ASN or company name)
 

EN   |  RU  

  Your ip: 54.167.95.51      AMAZON-2011L     AS14618     
United States  
  Details...    Login    166 


DNS server ns1.kyberna.net

ip address:
number of zones:211
primary zones:207
secondary zones:3
unknown:1


Zone list.

N zone type N zone type
1aak-allgemeine-ausgleichskasse.comprimary 2adler.liprimary
3admahk.comprimary 4admintrust.chprimary
5admintrust.comprimary 6admintrust.euprimary
7admintrust.liprimary 8admintrust.netprimary
9adoption-assistance.chprimary 10aidespirituelle.netprimary
11aiutospirituale.chprimary 12aiutospirituale.netprimary
13akzent-parkett.chprimary 14aleapartners.comprimary
15alemanniakredit.chprimary 16alliedfinance.comprimary
17alpe-adria-privatbank.comprimary 18alpe-adria-privatbank.liprimary
19amann.ccprimary 20antefores3107.comprimary
21apg-audit.comprimary 22apg-audit.liprimary
23apgaudit.comprimary 24apgaudit.liprimary
25aproma.chprimary 26ara-buchs.chprimary
27ardimedia.comsecondary 28areva.liprimary
29as39145.netprimary 30audit.liprimary
31auktion-ag.chprimary 32auktion-be.chprimary
33auktion-bl.chprimary 34auktion-sg.chprimary
35awico.liprimary 36azv.liprimary
37balleristo.comsecondary 38bargetze.liprimary
39bch-ag.chprimary 40bch-ag.comprimary
41beachvolley.liprimary 42bekleidung.liprimary
43betauniversal.comprimary 44blackford.netprimary
45brogle-fashion.liprimary 46bvd.liunknown
47caan.liprimary 48censorpark.liprimary
49chemichl.comprimary 50chikudo.liprimary
51chiptech.atprimary 52christentum.chprimary
53christentum.liprimary 54cma.liprimary
55csag.liprimary 56dariocologna.comprimary
57daxx.chprimary 58denim.liprimary
59design-urne.comprimary 60dosiplast.comprimary
61duxtrust.comprimary 62e-autoindex.chprimary
63e-postcard.liprimary 64easy-cap.atprimary
65eautoindex.chprimary 66emtipp.liprimary
67encheres-be.chprimary 68encheres-vd.chprimary
69esprit.liprimary 70estamp.liprimary
71etimark-extranet.chprimary 72etimark-intranet.chprimary
73fidium.chprimary 74football.liprimary
75fscl.liprimary 76fseartemis.comprimary
77fussball.liprimary 78fussballverband.liprimary
79gallusfinanz.chprimary 80gamprin-bendern.liprimary
81gassnerbau.liprimary 82geldbrief.atprimary
83geldbrief.liprimary 84glz.liprimary
85greatstationproperties.comprimary 86haustechnik-online.chprimary
87heimspiel.liprimary 88hilfswerkliechtenstein.liprimary
89hiltongolf.chprimary 90hobauag.comprimary
91hoettlebikers.liprimary 92holzkonzept.chprimary
93ifa-fl.liprimary 94infidas.comprimary
95internet-seelsorge.chprimary 96internetseelsorge.chprimary
97interverta.chprimary 98it-service-management-software.chprimary
99it-service-management-software.comprimary 100it-service-management.chprimary
101itservicemanagement.chprimary 102itsm.liprimary
103itwartemis.comprimary 104jud.liprimary
105kasimir.liprimary 106kinderarzt-hard.atprimary
107ky-center.euprimary 108ky2help-konferenz.liprimary
109ky2help.atprimary 110ky2help.chprimary
111ky2help.deprimary 112ky2help.euprimary
113ky2help.liprimary 114ky2helpkonferenz.liprimary
115ky4workplace.chprimary 116kyberna.chprimary
117kyberna.deprimary 118kyberna.liprimary
119kybi.liprimary 120kynet.liprimary
121latvia.liprimary 122lba.liprimary
123led.liprimary 124leoag.itprimary
125lfv.liprimary 126lfvaward.liprimary
127liba2012.liprimary 128liechtenstein-hosting.comprimary
129liemobil.liprimary 130liepostcard.liprimary
131liezertifikat.liprimary 132lihga.liprimary
133linexa.comprimary 134linexa.liprimary
135lirak.liprimary 136lsv.liprimary
137luechinger.liprimary 138mandorit.liprimary
139mantuitor.roprimary 140marcokoeppel.chprimary
141marcopolo.liprimary 142meiertrans.chprimary
143mexx.liprimary 144moneycab.chprimary
145moneycab.comprimary 146mzsgp.comprimary
147nagelstudio-prisca.chprimary 148o-o.liprimary
149oekotech.liprimary 150optimum-investments.comprimary
151ospelt.ccprimary 152ospeltelektro.comprimary
153ospeltelektro.liprimary 154parrocchiainternet.netprimary
155pastoral-care.netprimary 156postcard.liprimary
157postgate.euprimary 158postkarte.liprimary
159presscab.comprimary 160privatewealthcouncil.comprimary
161privatewealthcouncil.orgprimary 162pwz.liprimary
163ratataetsch.liprimary 164requiemforyou.atprimary
165requiemforyou.chprimary 166requiemforyou.comprimary
167requiemforyou.liprimary 168riedmann.luprimary
169risk2me.comprimary 170ritronik.liprimary
171ritter-partner.comprimary 172ritter-partner.liprimary
173rolandforrer.chprimary 174royalis.lisecondary
175rustico-holz.chprimary 176schlosswald.liprimary
177schuetzenbuchs-raefis.chprimary 178schweizerkredit.chprimary
179schweizerkredite.chprimary 180seelsorge.liprimary
181seelsorge.netprimary 182segas.chprimary
183sercalo.chprimary 184sercor.comprimary
185sermont.comprimary 186sigma.liprimary
187sigmakreditbank.chprimary 188sigmakreditbank.liprimary
189sms-seelsorge.chprimary 190smsseelsorge.chprimary
191soccer.liprimary 192spaghettissimo.comprimary
193spc.liprimary 194stall-rheintal.chprimary
195taokungfu.atprimary 196trendpresse.chprimary
197treuhand-buero.liprimary 198trutenfarm.liprimary
199vamax-int.comprimary 200vba.liprimary
201versicherungen-buchs-sg.chprimary 202volksbank.liprimary
203wehobau.chprimary 204whlaw.liprimary
205wirtschaftspruefung.liprimary 206wmtipp.liprimary
207woc.atprimary 208wohlmachers-turm.atprimary
209treuhand-büro.liprimary 210zahnaerzte.liprimary
211zelte.liprimary